PDB entry 4qsq

View 4qsq on RCSB PDB site
Description: Structure of the bromodomain of human ATPase family AAA domain-containing protein 2 (ATAD2) with bound DMSO
Class: signaling protein
Keywords: Structural Genomics Consortium (SGC), SIGNALING PROTEIN, bromodomain, actyl-lysine binding, ATPase family AAA domain-containing protein 2, epigenetics
Deposited on 2014-07-06, released 2014-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATPase family AAA domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ATAD2, L16, PRO2000
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PL18 (2-129)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d4qsqa1, d4qsqa2
  • Heterogens: DMS, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qsqA (A:)
    smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
    dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
    qlceeiqesr