SCOPe 2.07: Domain d4o3ya4: 4o3y A:385-528

Lineage for d4o3ya4 (4o3y A:385-528)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.0: automated matches [191664] (1 protein)
   not a true family

6. Protein automated matches [191257] (6 species)
   not a true protein

7. Species Actinobacillus pleuropneumoniae [TaxId:715] [311328] (4 PDB entries)

8. Domain d4o3ya4: 4o3y A:385-528 [307807]
   Other proteins in same PDB: d4o3ya1, d4o3ya3
   automated match to d3hola2
   complexed with act, gol; mutant

Details for d4o3ya4

PDB Entry: 4o3y, 2.6 Å

PDB Description: crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant arg-179-glu from actinobacillus pleuropneumoniae h87

PDB Compounds: (A:) Outer membrane protein; transferrin-binding protein

SCOPe Domain Sequences for d4o3ya4:

Sequence, based on SEQRES records:

>d4o3ya4 f.4.1.0 (A:385-528) automated matches {Actinobacillus pleuropneumoniae [TaxId: 715]}
atdkipvggnykyvgtwdalvskgtnwvaeadnnresgyrsefdvnfgdkkvsgklfdkg
givpvfminadikgngftgtanttdtgfaldsgssqhgnavfsdikvnggfygptagelg
gqfhhksdngsvgavfgakrqiek

Sequence, based on observed residues (ATOM records):

>d4o3ya4 f.4.1.0 (A:385-528) automated matches {Actinobacillus pleuropneumoniae [TaxId: 715]}
atdkipvggnykyvgtwdalvskgtnwvaeadnnresgyrsefdvnfgdkkvsgklfdkg
givpvfminadikgngftgtanttdtgfaldssqhgnavfsdikvnggfygptagelggq
fhhksdngsvgavfgakrqiek

Timeline for d4o3ya4:

• d4o3ya4 first appeared in SCOPe 2.06
  
• d4o3ya4 appears in the current release, SCOPe 2.08