Class b: All beta proteins [48724] (178 folds) |
Fold b.181: Handle domain of Transferrin binding protein TbpB-like [310564] (1 superfamily) 2 layers; antiparallel B-sheet, order 1432 or 216543, flanked by alpha helix or 2-strand beta hairpin |
Superfamily b.181.1: Handle domain of Transferrin binding protein TbpB-like [310592] (2 families) C-terminal part of Pfam PF01298 |
Family b.181.1.0: automated matches [310674] (1 protein) not a true family |
Protein automated matches [310874] (3 species) not a true protein |
Species Actinobacillus pleuropneumoniae [TaxId:715] [311327] (4 PDB entries) |
Domain d4o3ya3: 4o3y A:296-384 [307806] Other proteins in same PDB: d4o3ya2, d4o3ya4 automated match to d3hola4 complexed with act, gol; mutant |
PDB Entry: 4o3y (more details), 2.6 Å
SCOPe Domain Sequences for d4o3ya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o3ya3 b.181.1.0 (A:296-384) automated matches {Actinobacillus pleuropneumoniae [TaxId: 715]} idaskidlttfesselnnfgnanvliidgqkidlagadfknrktvdingktmvaiaccsn leymkfgqlwqkegeqtkdnslflqgert
Timeline for d4o3ya3: