Lineage for d4o3ya1 (4o3y A:26-137)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434508Fold b.181: Handle domain of Transferrin binding protein TbpB-like [310564] (1 superfamily)
    2 layers; antiparallel B-sheet, order 1432 or 216543, flanked by alpha helix or 2-strand beta hairpin
  4. 2434509Superfamily b.181.1: Handle domain of Transferrin binding protein TbpB-like [310592] (2 families) (S)
    C-terminal part of Pfam PF01298
  5. 2434518Family b.181.1.0: automated matches [310674] (1 protein)
    not a true family
  6. 2434519Protein automated matches [310874] (3 species)
    not a true protein
  7. 2434520Species Actinobacillus pleuropneumoniae [TaxId:715] [311327] (4 PDB entries)
  8. 2434525Domain d4o3ya1: 4o3y A:26-137 [307804]
    Other proteins in same PDB: d4o3ya2, d4o3ya4
    automated match to d3hola3
    complexed with act, gol; mutant

Details for d4o3ya1

PDB Entry: 4o3y (more details), 2.6 Å

PDB Description: crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant arg-179-glu from actinobacillus pleuropneumoniae h87
PDB Compounds: (A:) Outer membrane protein; transferrin-binding protein

SCOPe Domain Sequences for d4o3ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o3ya1 b.181.1.0 (A:26-137) automated matches {Actinobacillus pleuropneumoniae [TaxId: 715]}
vnytdeetqkrkkeeldklmepalgyvtkipvnipsvrkteiseidtvtdeslslvpned
klrtianenygsvvtksgsntmnfvrsgytidvvhyglrdkgyvyykgvhps

SCOPe Domain Coordinates for d4o3ya1:

Click to download the PDB-style file with coordinates for d4o3ya1.
(The format of our PDB-style files is described here.)

Timeline for d4o3ya1: