SCOPe 2.08: Domain d4fkka1: 4fkk A:63-282

Lineage for d4fkka1 (4fkk A:63-282)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (5 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [311377] (18 PDB entries)

8. Domain d4fkka1: 4fkk A:63-282 [307372]
   Other proteins in same PDB: d4fkka2, d4fkka3, d4fkka4, d4fkka5
   automated match to d4fyqa1
   complexed with bes, nag, zn

Details for d4fkka1

PDB Entry: 4fkk, 2.6 Å

PDB Description: crystal structure of porcine aminopeptidase-n complexed with bestatin

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4fkka1:

Sequence; same for both SEQRES and ATOM records:

>d4fkka1 b.98.1.0 (A:63-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskk
lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
nmppkgsstplaedpnwsvtefettpvmstyllayivsef

Timeline for d4fkka1:

• d4fkka1 first appeared in SCOPe 2.06
  
• d4fkka1 appears in SCOPe 2.07