| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
| Protein automated matches [190805] (20 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries) |
| Domain d4fkka2: 4fkk A:283-544 [307373] Other proteins in same PDB: d4fkka1, d4fkka3, d4fkka4, d4fkka5 automated match to d4fyta2 complexed with bes, nag, zn |
PDB Entry: 4fkk (more details), 2.6 Å
SCOPe Domain Sequences for d4fkka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fkka2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp
dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl
wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq
isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda
qtsirlpdtvraimdrwtlqmg
Timeline for d4fkka2:
View in 3DDomains from same chain: (mouse over for more information) d4fkka1, d4fkka3, d4fkka4, d4fkka5 |