PDB entry 4fkk

View 4fkk on RCSB PDB site
Description: Crystal structure of porcine aminopeptidase-N complexed with bestatin
Class: hydrolase/hydrolase inhibitor
Keywords: zinc aminopeptidase-N, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-06-13, released 2012-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.17
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Sus scrofa [TaxId:9823]
    Gene: ANPEP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15145 (Start-901)
      • conflict (20)
      • conflict (45)
      • expression tag (902)
    Domains in SCOPe 2.07: d4fkka1, d4fkka2, d4fkka3, d4fkka4, d4fkka5
  • Heterogens: NAG, BES, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fkkA (A:)
    dqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihsk
    klnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgel
    addlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltal
    snmppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarp
    naiaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrena
    llfdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhae
    ptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirm
    lsnfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtl
    qmgfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdv
    sqaqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviyd
    sfnlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrk
    qveplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpe
    nnpihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnry
    lgytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqg
    vtrrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfie
    hsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fkkA (A:)
    qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskk
    lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
    ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
    nmppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpn
    aiaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenal
    lfdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaep
    twnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirml
    snfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlq
    mgfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvs
    qaqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviyds
    fnlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkq
    veplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpen
    npihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnryl
    gytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgv
    trrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfieh
    ss