![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
![]() | Protein automated matches [190220] (14 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [311380] (18 PDB entries) |
![]() | Domain d4fkea4: 4fke A:634-963 [307365] Other proteins in same PDB: d4fkea1, d4fkea2, d4fkea3, d4fkea5 automated match to d4fyta4 complexed with nag, zn |
PDB Entry: 4fke (more details), 1.85 Å
SCOPe Domain Sequences for d4fkea4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fkea4 a.118.1.0 (A:634-963) automated matches {Pig (Sus scrofa) [TaxId: 9823]} dnwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlaldntlflngekeympwq aalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwterpenlmdqyseina istacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnaiaqggqdqwdfawgql qqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdatstinsiasnvigqpla wdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqfkknnmdvgfgsgtra leqalektkanikwvkenkevvlnwfiehs
Timeline for d4fkea4:
![]() Domains from same chain: (mouse over for more information) d4fkea1, d4fkea2, d4fkea3, d4fkea5 |