SCOP 1.61: Domain d3ezba2: 3ezb A:1-21,A:145-259

Lineage for d3ezba2 (3ezb A:1-21,A:145-259)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)

4. Superfamily c.8.1: Phosphohistidine domain [52009] (2 families)

5. Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)

6. Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)

7. Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)

8. Domain d3ezba2: 3ezb A:1-21,A:145-259 [30715]
   Other proteins in same PDB: d3ezba1, d3ezbb_

Details for d3ezba2

PDB Entry: 3ezb

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli

SCOP Domain Sequences for d3ezba2:

Sequence; same for both SEQRES and ATOM records:

>d3ezba2 c.8.1.2 (A:1-21,A:145-259) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli}
misgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitd
aggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmrav
qeqvasekaelaklkdr

Timeline for d3ezba2:

• d3ezba2 first appeared (with stable ids) in SCOP 1.55
  
• d3ezba2 appears in SCOP 1.59
  
• d3ezba2 appears in SCOP 1.63
  
• d3ezba2 appears in the current release, SCOPe 2.08