Lineage for d3ezba2 (3ezb A:1-21,A:145-259)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2850951Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) (S)
    contains barrel, closed, n=7, S=10
  5. 2850968Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)
  6. 2850969Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)
    contains 4-helical insert domain, residues 22-144
  7. 2850970Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)
  8. 2850973Domain d3ezba2: 3ezb A:1-21,A:145-259 [30715]
    Other proteins in same PDB: d3ezba1, d3ezbb_

Details for d3ezba2

PDB Entry: 3ezb (more details)

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli
PDB Compounds: (A:) protein (phosphotransfer system, enzyme I)

SCOPe Domain Sequences for d3ezba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezba2 c.8.1.2 (A:1-21,A:145-259) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli [TaxId: 562]}
misgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitd
aggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmrav
qeqvasekaelaklkdr

SCOPe Domain Coordinates for d3ezba2:

Click to download the PDB-style file with coordinates for d3ezba2.
(The format of our PDB-style files is described here.)

Timeline for d3ezba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ezba1
View in 3D
Domains from other chains:
(mouse over for more information)
d3ezbb_