| Class a: All alpha proteins [46456] (151 folds) |
| Fold a.60: SAM domain-like [47768] (11 superfamilies) |
Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family) ![]() |
| Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein) |
| Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species) |
| Species Escherichia coli [TaxId:562] [47834] (11 PDB entries) |
| Domain d3ezba1: 3ezb A:22-144 [18120] Other proteins in same PDB: d3ezba2, d3ezbb_ |
PDB Entry: 3ezb (more details)
SCOP Domain Sequences for d3ezba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezba1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl
Timeline for d3ezba1: