SCOPe 2.08: Domain d3ezba1: 3ezb A:22-144

Lineage for d3ezba1 (3ezb A:22-144)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family)

5. Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)

6. Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
   inserted in the phosphohistidine domain

7. Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)

8. Domain d3ezba1: 3ezb A:22-144 [18120]
   Other proteins in same PDB: d3ezba2, d3ezbb_

Details for d3ezba1

PDB Entry: 3ezb

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli

PDB Compounds: (A:) protein (phosphotransfer system, enzyme I)

SCOPe Domain Sequences for d3ezba1:

Sequence; same for both SEQRES and ATOM records:

>d3ezba1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli [TaxId: 562]}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

Timeline for d3ezba1:

• d3ezba1 first appeared (with stable ids) in SCOP 1.55
  
• d3ezba1 appears in SCOPe 2.07