![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein automated matches [227027] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225840] (10 PDB entries) |
![]() | Domain d4cjyb1: 4cjy B:22-157 [307121] Other proteins in same PDB: d4cjyc_, d4cjyd_ automated match to d2i53a1 |
PDB Entry: 4cjy (more details), 3.15 Å
SCOPe Domain Sequences for d4cjyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cjyb1 a.74.1.1 (B:22-157) automated matches {Human (Homo sapiens) [TaxId: 9606]} pcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhrf ymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeevm vlerillqtikfdlqv
Timeline for d4cjyb1:
![]() Domains from other chains: (mouse over for more information) d4cjya1, d4cjya2, d4cjyc_, d4cjyd_ |