Lineage for d4cjyc_ (4cjy C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2222237Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)
  8. 2223473Domain d4cjyc_: 4cjy C: [307123]
    Other proteins in same PDB: d4cjya1, d4cjya2, d4cjyb1, d4cjyb2
    automated match to d4nsta_

Details for d4cjyc_

PDB Entry: 4cjy (more details), 3.15 Å

PDB Description: Crystal structure of the human CDK12-cyclinK complex
PDB Compounds: (C:) cyclin-dependent kinase 12

SCOPe Domain Sequences for d4cjyc_:

Sequence, based on SEQRES records: (download)

>d4cjyc_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireikil
rqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfsedhiks
fmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvit
lwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpa
vwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsd
flkdvelskmapp

Sequence, based on observed residues (ATOM records): (download)

>d4cjyc_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireikil
rqlihrsvvnmkeivtdkkdkgafylvfeymdhdlmgllesglvhfsedhiksfmkqlme
gleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvitlwyrppe
lllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpdvik
lpyfntmkpqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkdvelsk
mapp

SCOPe Domain Coordinates for d4cjyc_:

Click to download the PDB-style file with coordinates for d4cjyc_.
(The format of our PDB-style files is described here.)

Timeline for d4cjyc_: