SCOPe 2.06: Domain d3wmoh1: 3wmo H:2-43

Lineage for d3wmoh1 (3wmo H:2-43)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.0: automated matches [227192] (1 protein)
   not a true family

6. Protein automated matches [226917] (3 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [267910] (3 PDB entries)

8. Domain d3wmoh1: 3wmo H:2-43 [306795]
   Other proteins in same PDB: d3wmo0_, d3wmo1_, d3wmo2_, d3wmo4_, d3wmo5_, d3wmo6_, d3wmo7_, d3wmo8_, d3wmo9_, d3wmoa_, d3wmob_, d3wmoc_, d3wmod_, d3wmoe_, d3wmof_, d3wmog_, d3wmoh2, d3wmoi_, d3wmoj_, d3wmom_, d3wmon_, d3wmop_, d3wmor_, d3wmot_, d3wmov_, d3wmox_, d3wmoy_, d3wmoz_
   automated match to d3wmmh1
   complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmoh1

PDB Entry: 3wmo, 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form

PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d3wmoh1:

Sequence; same for both SEQRES and ATOM records:

>d3wmoh1 f.23.10.0 (H:2-43) automated matches {Thermochromatium tepidum [TaxId: 1050]}
sagithyidaaqitiwafwlfffgliiylrredkregyplds

Timeline for d3wmoh1:

• d3wmoh1 is new in SCOPe 2.06-stable
  
• d3wmoh1 appears in SCOPe 2.07
  
• d3wmoh1 appears in the current release, SCOPe 2.08