SCOPe 2.06: Domain d3wmoh2: 3wmo H:44-259

Lineage for d3wmoh2 (3wmo H:44-259)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein automated matches [226918] (3 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [267913] (3 PDB entries)

8. Domain d3wmoh2: 3wmo H:44-259 [306796]
   Other proteins in same PDB: d3wmo0_, d3wmo1_, d3wmo2_, d3wmo4_, d3wmo5_, d3wmo6_, d3wmo7_, d3wmo8_, d3wmo9_, d3wmoa_, d3wmob_, d3wmoc_, d3wmod_, d3wmoe_, d3wmof_, d3wmog_, d3wmoh1, d3wmoi_, d3wmoj_, d3wmom_, d3wmon_, d3wmop_, d3wmor_, d3wmot_, d3wmov_, d3wmox_, d3wmoy_, d3wmoz_
   automated match to d3wmmh2
   complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmoh2

PDB Entry: 3wmo, 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form

PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d3wmoh2:

Sequence; same for both SEQRES and ATOM records:

>d3wmoh2 b.41.1.1 (H:44-259) automated matches {Thermochromatium tepidum [TaxId: 1050]}
drtersggrvkvvgfpdlpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpn
gdpmlsgfgpaaspdrpkhcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgev
agtvsdvwvdrsepqirylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvp
tlsnpdqvtlyeedkvcayyaggklyataeragpll

Timeline for d3wmoh2:

• d3wmoh2 is new in SCOPe 2.06-stable
  
• d3wmoh2 appears in SCOPe 2.07
  
• d3wmoh2 appears in the current release, SCOPe 2.08