Lineage for d3wmoh1 (3wmo H:2-43)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630999Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2631129Family f.23.10.0: automated matches [227192] (1 protein)
    not a true family
  6. 2631130Protein automated matches [226917] (6 species)
    not a true protein
  7. 2631150Species Thermochromatium tepidum [TaxId:1050] [267910] (5 PDB entries)
  8. 2631154Domain d3wmoh1: 3wmo H:2-43 [306795]
    Other proteins in same PDB: d3wmo0_, d3wmo1_, d3wmo2_, d3wmo3_, d3wmo4_, d3wmo5_, d3wmo6_, d3wmo7_, d3wmo8_, d3wmo9_, d3wmoa_, d3wmob_, d3wmoc_, d3wmod_, d3wmoe_, d3wmof_, d3wmog_, d3wmoh2, d3wmoi_, d3wmoj_, d3wmok_, d3wmom_, d3wmon_, d3wmoo_, d3wmop_, d3wmoq_, d3wmor_, d3wmos_, d3wmot_, d3wmou_, d3wmov_, d3wmow_, d3wmox_, d3wmoy_, d3wmoz_
    automated match to d3wmmh1
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, po4, uq8

Details for d3wmoh1

PDB Entry: 3wmo (more details), 3.01 Å

PDB Description: Crystal structure of the LH1-RC complex from Thermochromatium tepidum in P21 form
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d3wmoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmoh1 f.23.10.0 (H:2-43) automated matches {Thermochromatium tepidum [TaxId: 1050]}
sagithyidaaqitiwafwlfffgliiylrredkregyplds

SCOPe Domain Coordinates for d3wmoh1:

Click to download the PDB-style file with coordinates for d3wmoh1.
(The format of our PDB-style files is described here.)

Timeline for d3wmoh1: