Lineage for d3othb_ (3oth B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2911058Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2911059Protein automated matches [190965] (40 species)
    not a true protein
  7. 2911156Species Micromonospora echinospora [TaxId:1877] [311324] (2 PDB entries)
  8. 2911159Domain d3othb_: 3oth B: [306174]
    Other proteins in same PDB: d3otha2
    automated match to d2p6pa_
    complexed with clj, tyd

Details for d3othb_

PDB Entry: 3oth (more details), 2.3 Å

PDB Description: crystal structure of calg1, calicheamicin glycostyltransferase, tdp and calicheamicin alpha3i bound form
PDB Compounds: (B:) CalG1

SCOPe Domain Sequences for d3othb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3othb_ c.87.1.0 (B:) automated matches {Micromonospora echinospora [TaxId: 1877]}
mrvlfaslgthghtypllplataaraaghevtfatgegfagtlrklgfepvatgmpvfdg
flaalrirfdtdspegltpeqlselpqivfgrvipqrvfdelqpvierlrpdlvvqeisn
ygaglaalkagiptichgvgrdtpddltrsieeevrglaqrlgldlppgridgfgnpfid
ifppslqepefrarprrhelrpvpfaeqgdlpawlssrdtarplvyltlgtssggtvevl
raaidglagldadvlvasgpsldvsglgevpanvrleswvpqaallphvdlvvhhggsgt
tlgalgagvpqlsfpwagdsfanaqavaqagagdhllpdnispdsvsgaakrllaeesyr
agaravaaeiaampgpdevvrllpgfas

SCOPe Domain Coordinates for d3othb_:

Click to download the PDB-style file with coordinates for d3othb_.
(The format of our PDB-style files is described here.)

Timeline for d3othb_: