SCOPe 2.08: Domain d3othb_: 3oth B:

Lineage for d3othb_ (3oth B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.0: automated matches [191559] (1 protein)
   not a true family

6. Protein automated matches [190965] (40 species)
   not a true protein

7. Species Micromonospora echinospora [TaxId:1877] [311324] (2 PDB entries)

8. Domain d3othb_: 3oth B: [306174]
   Other proteins in same PDB: d3otha2
   automated match to d2p6pa_
   complexed with clj, tyd

Details for d3othb_

PDB Entry: 3oth, 2.3 Å

PDB Description: crystal structure of calg1, calicheamicin glycostyltransferase, tdp and calicheamicin alpha3i bound form

PDB Compounds: (B:) CalG1

SCOPe Domain Sequences for d3othb_:

Sequence; same for both SEQRES and ATOM records:

>d3othb_ c.87.1.0 (B:) automated matches {Micromonospora echinospora [TaxId: 1877]}
mrvlfaslgthghtypllplataaraaghevtfatgegfagtlrklgfepvatgmpvfdg
flaalrirfdtdspegltpeqlselpqivfgrvipqrvfdelqpvierlrpdlvvqeisn
ygaglaalkagiptichgvgrdtpddltrsieeevrglaqrlgldlppgridgfgnpfid
ifppslqepefrarprrhelrpvpfaeqgdlpawlssrdtarplvyltlgtssggtvevl
raaidglagldadvlvasgpsldvsglgevpanvrleswvpqaallphvdlvvhhggsgt
tlgalgagvpqlsfpwagdsfanaqavaqagagdhllpdnispdsvsgaakrllaeesyr
agaravaaeiaampgpdevvrllpgfas

Timeline for d3othb_:

• d3othb_ first appeared in SCOPe 2.06
  
• d3othb_ appears in SCOPe 2.07