Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) |
Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
Protein automated matches [190965] (40 species) not a true protein |
Species Micromonospora echinospora [TaxId:1877] [311324] (2 PDB entries) |
Domain d3otha1: 3oth A:1-388 [306172] Other proteins in same PDB: d3otha2 automated match to d2p6pa_ complexed with clj, tyd |
PDB Entry: 3oth (more details), 2.3 Å
SCOPe Domain Sequences for d3otha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3otha1 c.87.1.0 (A:1-388) automated matches {Micromonospora echinospora [TaxId: 1877]} mrvlfaslgthghtypllplataaraaghevtfatgegfagtlrklgfepvatgmpvfdg flaalrirfdtdspegltpeqlselpqivfgrvipqrvfdelqpvierlrpdlvvqeisn ygaglaalkagiptichgvgrdtpddltrsieeevrglaqrlgldlppgridgfgnpfid ifppslqepefrarprrhelrpvpfaeqgdlpawlssrdtarplvyltlgtssggtvevl raaidglagldadvlvasgpsldvsglgevpanvrleswvpqaallphvdlvvhhggsgt tlgalgagvpqlsfpwagdsfanaqavaqagagdhllpdnispdsvsgaakrllaeesyr agaravaaeiaampgpdevvrllpgfas
Timeline for d3otha1: