Lineage for d3n48a_ (3n48 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299707Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2299773Species Dog (Canis familiaris) [TaxId:9615] [189534] (3 PDB entries)
  8. 2299775Domain d3n48a_: 3n48 A: [306016]
    Other proteins in same PDB: d3n48b_
    automated match to d3pela_
    complexed with hem, oxy

Details for d3n48a_

PDB Entry: 3n48 (more details), 1.9 Å

PDB Description: Structural Analysis of R-state Greyhound Hemoglobin
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3n48a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n48a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Dog (Canis familiaris) [TaxId: 9615]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkffaavstvltskyr

SCOPe Domain Coordinates for d3n48a_:

Click to download the PDB-style file with coordinates for d3n48a_.
(The format of our PDB-style files is described here.)

Timeline for d3n48a_: