SCOPe 2.06: Domain d3n48a_: 3n48 A:

Lineage for d3n48a_ (3n48 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [189534] (3 PDB entries)

8. Domain d3n48a_: 3n48 A: [306016]
   Other proteins in same PDB: d3n48b_
   automated match to d3pela_
   complexed with hem, oxy

Details for d3n48a_

PDB Entry: 3n48, 1.9 Å

PDB Description: Structural Analysis of R-state Greyhound Hemoglobin

PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3n48a_:

Sequence; same for both SEQRES and ATOM records:

>d3n48a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Dog (Canis familiaris) [TaxId: 9615]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkffaavstvltskyr

Timeline for d3n48a_:

• d3n48a_ is new in SCOPe 2.06-stable
  
• d3n48a_ appears in SCOPe 2.07
  
• d3n48a_ appears in the current release, SCOPe 2.08