| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (24 species) |
| Species Dog (Canis familiaris) [TaxId:9615] [189534] (3 PDB entries) |
| Domain d3n48a_: 3n48 A: [306016] Other proteins in same PDB: d3n48b_ automated match to d3pela_ complexed with hem, oxy |
PDB Entry: 3n48 (more details), 1.9 Å
SCOPe Domain Sequences for d3n48a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n48a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Dog (Canis familiaris) [TaxId: 9615]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkffaavstvltskyr
Timeline for d3n48a_: