Lineage for d3iqsa_ (3iqs A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166092Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2166093Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2166304Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2166328Protein automated matches [310855] (3 species)
    not a true protein
  7. 2166329Species Human (Homo sapiens) [TaxId:9606] [311219] (18 PDB entries)
  8. 2166348Domain d3iqsa_: 3iqs A: [305583]
    automated match to d4xxoa_
    complexed with zn

Details for d3iqsa_

PDB Entry: 3iqs (more details), 2.3 Å

PDB Description: Crystal structure of the anti-viral APOBEC3G catalytic domain
PDB Compounds: (A:) DNA dC->dU-editing enzyme APOBEC-3G

SCOPe Domain Sequences for d3iqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iqsa_ c.97.1.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdpptftfnfnnepwvrgrhetylcyevermhndtwvllnqrrgflcnqaphkhgflegr
haelcfldvipfwkldldqdyrvtcftswspcfscaqemakfisknkhvslciftariyd
dqgrcqeglrtlaeagakisimtysefkhcwdtfvdhqgcpfqpwdgldehsqdlsgrlr
ailq

SCOPe Domain Coordinates for d3iqsa_:

Click to download the PDB-style file with coordinates for d3iqsa_.
(The format of our PDB-style files is described here.)

Timeline for d3iqsa_: