Lineage for d4xxoa_ (4xxo A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the restSuperfamily c.97.1: Cytidine deaminase-like [53927] (7 families) 
contains extra C-terminal strand 5, order 21345
Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
strand 5 is parallel to strand 4
Pfam PF08210; Pfam PF05240
Protein APOBEC3A [310759] (1 species) Species Human (Homo sapiens) [TaxId:9606] [311014] (2 PDB entries) 
Domain d4xxoa_: 4xxo A: [310086]
complexed with cl, zn
Details for d4xxoa_
PDB Entry: 4xxo (more details), 2.84 Å
PDB Description: crystal structure of human apobec3a
PDB Compounds: (A:) DNA dC->dU-editing enzyme APOBEC-3ASCOPe Domain Sequences for d4xxoa_:
Sequence, based on SEQRES records: (download)
>d4xxoa_ c.97.1.6 (A:) APOBEC3A {Human (Homo sapiens) [TaxId: 9606]}
gprhlmdphiftsnfnngigrhktylcyeverldngtsvkmdqhrgflhnqaknllcgfy
grhaalrfldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthvrlrifaa
riydydplykealqmlrdagaqvsimtydefkhcwdtfvdhqgapfqpwdgldehsqals
grlrailqn
Sequence, based on observed residues (ATOM records): (download)
>d4xxoa_ c.97.1.6 (A:) APOBEC3A {Human (Homo sapiens) [TaxId: 9606]}
gprhlmdphiftsnfnngigrhktylcyeverldsvkmdqhrgflhnqaknllcgfygrh
aalrfldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthvrlrifaariy
dydplykealqmlrdagaqvsimtydefkhcwdtfvdhqgapfqpwdgldehsqalsgrl
railqn
SCOPe Domain Coordinates for d4xxoa_:
Click to download the PDB-style file with coordinates for d4xxoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4xxoa_:
- d4xxoa_ is new in SCOPe 2.06-stable
- d4xxoa_ appears in SCOPe 2.07
- d4xxoa_ appears in the current release, SCOPe 2.08
View in 3D
