SCOPe 2.07: Domain d3arch_: 3arc H:

Lineage for d3arch_ (3arc H:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein automated matches [191001] (5 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (7 PDB entries)

8. Domain d3arch_: 3arc H: [305007]
   Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arci_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcx_, d3arcz_
   automated match to d3bz2h_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arch_

PDB Entry: 3arc, 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d3arch_:

Sequence; same for both SEQRES and ATOM records:

>d3arch_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

Timeline for d3arch_:

• d3arch_ first appeared in SCOPe 2.06
  
• d3arch_ appears in the current release, SCOPe 2.08