Lineage for d3arch_ (3arc H:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254818Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
    automatically mapped to Pfam PF00737
  5. 2254819Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2254833Protein automated matches [191001] (3 species)
    not a true protein
  7. 2254841Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (5 PDB entries)
  8. 2254844Domain d3arch_: 3arc H: [305007]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arci_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcx_, d3arcz_
    automated match to d3bz2h_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arch_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d3arch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arch_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

SCOPe Domain Coordinates for d3arch_:

Click to download the PDB-style file with coordinates for d3arch_.
(The format of our PDB-style files is described here.)

Timeline for d3arch_: