SCOPe 2.06: Domain d3arcl_: 3arc L:

Lineage for d3arcl_ (3arc L:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (10 PDB entries)

8. Domain d3arcl_: 3arc L: [305011]
   Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arck_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcx_, d3arcz_
   automated match to d2axtl1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arcl_

PDB Entry: 3arc, 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution

PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d3arcl_:

Sequence; same for both SEQRES and ATOM records:

>d3arcl_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d3arcl_:

• d3arcl_ is new in SCOPe 2.06-stable
  
• d3arcl_ appears in SCOPe 2.07
  
• d3arcl_ appears in the current release, SCOPe 2.08