Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) automatically mapped to Pfam PF02419 |
Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (10 PDB entries) |
Domain d3arcl_: 3arc L: [305011] Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arck_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcx_, d3arcz_ automated match to d2axtl1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 3arc (more details), 1.9 Å
SCOPe Domain Sequences for d3arcl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3arcl_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]} mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d3arcl_: