Lineage for d3arcu_ (3arc U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329766Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2329767Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 2329772Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries)
  8. 2329774Domain d3arcu_: 3arc U: [305015]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcv_, d3arcx_, d3arcz_
    automated match to d4il6u_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arcu_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d3arcu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arcu_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d3arcu_:

Click to download the PDB-style file with coordinates for d3arcu_.
(The format of our PDB-style files is described here.)

Timeline for d3arcu_: