Lineage for d2vcrf1 (2vcr F:2-80)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.0: automated matches [191312] (1 protein)
not a true familyProtein automated matches [190056] (188 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries) 
Domain d2vcrf1: 2vcr F:2-80 [304518]
Other proteins in same PDB: d2vcra2, d2vcrb2, d2vcrc2, d2vcrd2, d2vcre2, d2vcrf2, d2vcrg2, d2vcrh2
automated match to d2vcta1
complexed with gsw
Details for d2vcrf1
PDB Entry: 2vcr (more details), 2.2 Å
PDB Description: glutathione transferase a2-2 in complex with glutathione
PDB Compounds: (F:) glutathione s-transferase a2SCOPe Domain Sequences for d2vcrf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcrf1 c.47.1.0 (F:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn
SCOPe Domain Coordinates for d2vcrf1:
Click to download the PDB-style file with coordinates for d2vcrf1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vcrf1:
View in 3D
