Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
Domain d2vcrf2: 2vcr F:81-222 [304519] Other proteins in same PDB: d2vcra1, d2vcrb1, d2vcrc1, d2vcrd1, d2vcre1, d2vcrf1, d2vcrg1, d2vcrh1 automated match to d2vcta2 complexed with gsw |
PDB Entry: 2vcr (more details), 2.2 Å
SCOPe Domain Sequences for d2vcrf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcrf2 a.45.1.1 (F:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]} lygkdikekalidmyiegiadlgemilllpftqpeeqdaklaliqektknryfpafekvl kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp gsprkppmdeksleesrkifrf
Timeline for d2vcrf2: