Lineage for d2vcrf2 (2vcr F:81-222)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein automated matches [226848] (13 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) 
Domain d2vcrf2: 2vcr F:81-222 [304519]
Other proteins in same PDB: d2vcra1, d2vcrb1, d2vcrc1, d2vcrd1, d2vcre1, d2vcrf1, d2vcrg1, d2vcrh1
automated match to d2vcta2
complexed with gsw
Details for d2vcrf2
PDB Entry: 2vcr (more details), 2.2 Å
PDB Description: glutathione transferase a2-2 in complex with glutathione
PDB Compounds: (F:) glutathione s-transferase a2SCOPe Domain Sequences for d2vcrf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcrf2 a.45.1.1 (F:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikekalidmyiegiadlgemilllpftqpeeqdaklaliqektknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleesrkifrf
SCOPe Domain Coordinates for d2vcrf2:
Click to download the PDB-style file with coordinates for d2vcrf2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vcrf2:
View in 3D
