Lineage for d2vcrd1 (2vcr D:2-80)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487517Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2487696Domain d2vcrd1: 2vcr D:2-80 [304514]
    Other proteins in same PDB: d2vcra2, d2vcrb2, d2vcrc2, d2vcrd2, d2vcre2, d2vcrf2, d2vcrg2, d2vcrh2
    automated match to d2vcta1
    complexed with gsw

Details for d2vcrd1

PDB Entry: 2vcr (more details), 2.2 Å

PDB Description: glutathione transferase a2-2 in complex with glutathione
PDB Compounds: (D:) glutathione s-transferase a2

SCOPe Domain Sequences for d2vcrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcrd1 c.47.1.0 (D:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d2vcrd1:

Click to download the PDB-style file with coordinates for d2vcrd1.
(The format of our PDB-style files is described here.)

Timeline for d2vcrd1: