SCOPe 2.08: Domain d2fnyw_: 2fny W:

Lineage for d2fnyw_ (2fny W:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (240 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d2fnyw_: 2fny W: [303870]
   Other proteins in same PDB: d2fnyg_, d2fnyh_, d2fnyu_, d2fnyv_
   automated match to d4eu2j_
   complexed with esy

Details for d2fnyw_

PDB Entry: 2fny, 3 Å

PDB Description: Homobelactosin C bound to the yeast 20S proteasome

PDB Compounds: (W:) Proteasome component PUP3

SCOPe Domain Sequences for d2fnyw_:

Sequence; same for both SEQRES and ATOM records:

>d2fnyw_ d.153.1.4 (W:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

Timeline for d2fnyw_:

• d2fnyw_ first appeared in SCOPe 2.06
  
• d2fnyw_ appears in SCOPe 2.07