Lineage for d2fnyh_ (2fny H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993878Domain d2fnyh_: 2fny H: [303856]
    Other proteins in same PDB: d2fny1_, d2fny2_, d2fnya_, d2fnyb_, d2fnyc_, d2fnye_, d2fnyf_, d2fnyi_, d2fnyj_, d2fnyk_, d2fnyl_, d2fnym_, d2fnyn_, d2fnyo_, d2fnyp_, d2fnyq_, d2fnys_, d2fnyt_, d2fnyw_, d2fnyx_, d2fnyy_, d2fnyz_
    automated match to d4r17h_
    complexed with esy

Details for d2fnyh_

PDB Entry: 2fny (more details), 3 Å

PDB Description: Homobelactosin C bound to the yeast 20S proteasome
PDB Compounds: (H:) Proteasome component PUP1

SCOPe Domain Sequences for d2fnyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnyh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d2fnyh_:

Click to download the PDB-style file with coordinates for d2fnyh_.
(The format of our PDB-style files is described here.)

Timeline for d2fnyh_: