Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d2fnyh_: 2fny H: [303856] Other proteins in same PDB: d2fny1_, d2fny2_, d2fnya_, d2fnyb_, d2fnyc_, d2fnye_, d2fnyf_, d2fnyi_, d2fnyj_, d2fnyk_, d2fnyl_, d2fnym_, d2fnyn_, d2fnyo_, d2fnyp_, d2fnyq_, d2fnys_, d2fnyt_, d2fnyw_, d2fnyx_, d2fnyy_, d2fnyz_ automated match to d4r17h_ complexed with esy |
PDB Entry: 2fny (more details), 3 Å
SCOPe Domain Sequences for d2fnyh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnyh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d2fnyh_: