Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (10 proteins) C-terminal domain is alpha+beta is common for the family |
Protein Sarcosine oxidase [51920] (1 species) |
Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (9 PDB entries) |
Domain d1el8b1: 1el8 B:1-217,B:322-385 [30374] Other proteins in same PDB: d1el8a2, d1el8b2 complexed with cl, fad, msf, po4 |
PDB Entry: 1el8 (more details), 1.9 Å
SCOP Domain Sequences for d1el8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1el8b1 c.3.1.2 (B:1-217,B:322-385) Sarcosine oxidase {Bacillus sp., strain b0618} sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq
Timeline for d1el8b1: