SCOPe 2.08: Domain d1el8b1: 1el8 B:1-217,B:322-385

Lineage for d1el8b1 (1el8 B:1-217,B:322-385)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Sarcosine oxidase [51920] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (17 PDB entries)

8. Domain d1el8b1: 1el8 B:1-217,B:322-385 [30374]
   Other proteins in same PDB: d1el8a2, d1el8b2
   complexed with cl, fad, msf, po4

Details for d1el8b1

PDB Entry: 1el8, 1.9 Å

PDB Description: complex of monomeric sarcosine oxidase with the inhibitor [methylseleno]cetate

PDB Compounds: (B:) sarcosine oxidase

SCOPe Domain Sequences for d1el8b1:

Sequence; same for both SEQRES and ATOM records:

>d1el8b1 c.3.1.2 (B:1-217,B:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq

Timeline for d1el8b1:

• d1el8b1 first appeared (with stable ids) in SCOP 1.55
  
• d1el8b1 appears in SCOPe 2.07