Lineage for d1zyaq1 (1zya Q:4-152,Q:319-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843784Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2843882Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (4 PDB entries)
    Uniprot Q8IKK7 4-152,319-335! Uniprot Q8T6B1 1-152,319-337
  8. 2843889Domain d1zyaq1: 1zya Q:4-152,Q:319-335 [303488]
    Other proteins in same PDB: d1zyao2, d1zyao3, d1zyao4, d1zyap2, d1zyap3, d1zyap4, d1zyaq2, d1zyaq3, d1zyaq4, d1zyar2, d1zyar3, d1zyar4
    automated match to d2b4ro1
    complexed with gol, nad

Details for d1zyaq1

PDB Entry: 1zya (more details), 2.25 Å

PDB Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum at 2.25 Resolution reveals intriguing extra electron density adjacent to the active site.
PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1zyaq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyaq1 c.2.1.3 (Q:4-152,Q:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
tklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevtha
dgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvimsa
ppkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhit

SCOPe Domain Coordinates for d1zyaq1:

Click to download the PDB-style file with coordinates for d1zyaq1.
(The format of our PDB-style files is described here.)

Timeline for d1zyaq1: