PDB entry 1zya

View 1zya on RCSB PDB site
Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum at 2.25 Resolution reveals intriguing extra electron density adjacent to the active site.
Class: oxidoreductase
Keywords: SGPP, Structural genomics, PSI, Protein Structure Initiative, GAPDH, glyceraldehyde-3-phosphate dehydrogenase, Structural Genomics of Pathogenic Protozoa Consortium
Deposited on 2005-06-09, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-10-04, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.181
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum 3D7
    Gene: PF14_0598
    Database cross-references and differences (RAF-indexed):
    • GB NP_702487
      • cloning mutation (10)
      • cloning mutation (343)
    Domains in SCOPe 2.07: d1zyao1, d1zyao2, d1zyao3, d1zyao4
  • Chain 'P':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum 3D7
    Gene: PF14_0598
    Database cross-references and differences (RAF-indexed):
    • GB NP_702487
      • cloning mutation (10)
      • cloning mutation (343)
    Domains in SCOPe 2.07: d1zyap1, d1zyap2, d1zyap3, d1zyap4
  • Chain 'Q':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum 3D7
    Gene: PF14_0598
    Database cross-references and differences (RAF-indexed):
    • GB NP_702487
      • cloning mutation (10)
      • cloning mutation (343)
    Domains in SCOPe 2.07: d1zyaq1, d1zyaq2, d1zyaq3, d1zyaq4
  • Chain 'R':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum 3D7
    Gene: PF14_0598
    Database cross-references and differences (RAF-indexed):
    • GB NP_702487
      • cloning mutation (10)
      • cloning mutation (343)
    Domains in SCOPe 2.07: d1zyar1, d1zyar2, d1zyar3, d1zyar4
  • Heterogens: NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1zyaO (O:)
    mahhhhhhmaatklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsv
    hgqfpcevthadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshl
    kggakkvimsappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiv
    eglmttvhastanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngklt
    gvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhd
    nrssifdmkaglalndnffklvswydnewgysnrvldlavhitts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyaO (O:)
    atklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevth
    adgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvims
    appkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvhas
    tanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpigt
    vsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdmka
    glalndnffklvswydnewgysnrvldlavhitt
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1zyaP (P:)
    mahhhhhhmaatklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsv
    hgqfpcevthadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshl
    kggakkvimsappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiv
    eglmttvhastanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngklt
    gvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhd
    nrssifdmkaglalndnffklvswydnewgysnrvldlavhitts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyaP (P:)
    atklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevth
    adgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvims
    appkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvhas
    tanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpigt
    vsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdmka
    glalndnffklvswydnewgysnrvldlavhitt
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1zyaQ (Q:)
    mahhhhhhmaatklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsv
    hgqfpcevthadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshl
    kggakkvimsappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiv
    eglmttvhastanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngklt
    gvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhd
    nrssifdmkaglalndnffklvswydnewgysnrvldlavhitts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyaQ (Q:)
    atklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevth
    adgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvims
    appkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvhas
    tanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpigt
    vsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdmka
    glalndnffklvswydnewgysnrvldlavhitt
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1zyaR (R:)
    mahhhhhhmaatklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsv
    hgqfpcevthadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshl
    kggakkvimsappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiv
    eglmttvhastanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngklt
    gvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhd
    nrssifdmkaglalndnffklvswydnewgysnrvldlavhitts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyaR (R:)
    atklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevth
    adgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvims
    appkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvhas
    tanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpigt
    vsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdmka
    glalndnffklvswydnewgysnrvldlavhitt