SCOPe 2.06: Domain d1z61a1: 1z61 A:63-130

Lineage for d1z61a1 (1z61 A:63-130)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.251.1: Phage replication organizer domain [140713] (1 family)
   DNA binding induces further oligomerization
   automatically mapped to Pfam PF06720

5. Family a.251.1.1: Phage replication organizer domain [140714] (2 proteins)
   Pfam PF06720

6. Protein automated matches [190518] (1 species)
   not a true protein

7. Species Bacillus phage [TaxId:10756] [187475] (4 PDB entries)

8. Domain d1z61a1: 1z61 A:63-130 [303434]
   Other proteins in same PDB: d1z61a2, d1z61b2
   automated match to d1zaea_

Details for d1z61a1

PDB Entry: 1z61

PDB Description: Solution structure of the functional domain of phi29 replication organizer p16.7C

PDB Compounds: (A:) early protein gp16.7

SCOPe Domain Sequences for d1z61a1:

Sequence; same for both SEQRES and ATOM records:

>d1z61a1 a.251.1.1 (A:63-130) automated matches {Bacillus phage [TaxId: 10756]}
dktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqk
klyrgslk

Timeline for d1z61a1:

• d1z61a1 is new in SCOPe 2.06-stable
  
• d1z61a1 appears in SCOPe 2.07
  
• d1z61a1 appears in the current release, SCOPe 2.08