| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.251: Phage replication organizer domain [140712] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.251.1: Phage replication organizer domain [140713] (1 family) ![]() DNA binding induces further oligomerization automatically mapped to Pfam PF06720 |
| Family a.251.1.1: Phage replication organizer domain [140714] (2 proteins) Pfam PF06720 |
| Protein automated matches [190518] (1 species) not a true protein |
| Species Bacillus phage [TaxId:10756] [187475] (4 PDB entries) |
| Domain d1z61a1: 1z61 A:63-130 [303434] Other proteins in same PDB: d1z61a2, d1z61b2 automated match to d1zaea_ |
PDB Entry: 1z61 (more details)
SCOPe Domain Sequences for d1z61a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z61a1 a.251.1.1 (A:63-130) automated matches {Bacillus phage [TaxId: 10756]}
dktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqk
klyrgslk
Timeline for d1z61a1: