Lineage for d1z61a1 (1z61 A:63-130)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738329Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2738330Superfamily a.251.1: Phage replication organizer domain [140713] (1 family) (S)
    DNA binding induces further oligomerization
    automatically mapped to Pfam PF06720
  5. 2738331Family a.251.1.1: Phage replication organizer domain [140714] (2 proteins)
    Pfam PF06720
  6. 2738335Protein automated matches [190518] (1 species)
    not a true protein
  7. 2738336Species Bacillus phage [TaxId:10756] [187475] (4 PDB entries)
  8. 2738344Domain d1z61a1: 1z61 A:63-130 [303434]
    Other proteins in same PDB: d1z61a2, d1z61b2
    automated match to d1zaea_

Details for d1z61a1

PDB Entry: 1z61 (more details)

PDB Description: Solution structure of the functional domain of phi29 replication organizer p16.7C
PDB Compounds: (A:) early protein gp16.7

SCOPe Domain Sequences for d1z61a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z61a1 a.251.1.1 (A:63-130) automated matches {Bacillus phage [TaxId: 10756]}
dktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqk
klyrgslk

SCOPe Domain Coordinates for d1z61a1:

Click to download the PDB-style file with coordinates for d1z61a1.
(The format of our PDB-style files is described here.)

Timeline for d1z61a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z61a2