SCOP 1.63: Domain d1djqb2: 1djq B:490-645

Lineage for d1djqb2 (1djq B:490-645)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (4 proteins)

6. Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species)
   N-terminal domain is beta/alpha barrel and the middle domain is alpha/beta Rossmann-fold

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (5 PDB entries)

8. Domain d1djqb2: 1djq B:490-645 [30316]
   Other proteins in same PDB: d1djqa1, d1djqa3, d1djqb1, d1djqb3

Details for d1djqb2

PDB Entry: 1djq, 2.2 Å

PDB Description: structural and biochemical characterization of recombinant c30a mutant of trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)

SCOP Domain Sequences for d1djqb2:

Sequence; same for both SEQRES and ATOM records:

>d1djqb2 c.3.1.1 (B:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1}
rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl
ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg
dgskrtyrgpgvsprdantshrwiefdslvlvtgrh

Timeline for d1djqb2:

• d1djqb2 first appeared (with stable ids) in SCOP 1.55
  
• d1djqb2 appears in SCOP 1.61
  
• d1djqb2 appears in SCOP 1.65
  
• d1djqb2 appears in the current release, SCOPe 2.08