SCOP 1.63: Domain d1djqb3: 1djq B:341-489,B:646-729

Lineage for d1djqb3 (1djq B:341-489,B:646-729)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (4 proteins)

6. Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (5 PDB entries)

8. Domain d1djqb3: 1djq B:341-489,B:646-729 [30601]
   Other proteins in same PDB: d1djqa1, d1djqa2, d1djqb1, d1djqb2

Details for d1djqb3

PDB Entry: 1djq, 2.2 Å

PDB Description: structural and biochemical characterization of recombinant c30a mutant of trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)

SCOP Domain Sequences for d1djqb3:

Sequence; same for both SEQRES and ATOM records:

>d1djqb3 c.4.1.1 (B:341-489,B:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1}
dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps
gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke
sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda
eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv

Timeline for d1djqb3:

• d1djqb3 first appeared (with stable ids) in SCOP 1.55
  
• d1djqb3 appears in SCOP 1.61
  
• d1djqb3 appears in SCOP 1.65
  
• d1djqb3 appears in the current release, SCOPe 2.08