Lineage for d1umma_ (1umm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691674Species Methylobacterium extorquens [311180] (1 PDB entry)
  8. 2691675Domain d1umma_: 1umm A: [303157]
    automated match to d2d0wa_
    complexed with ca, hem

Details for d1umma_

PDB Entry: 1umm (more details), 1.6 Å

PDB Description: cytochrome cl from methylobacterium extorquens
PDB Compounds: (A:) cytochrome cL

SCOPe Domain Sequences for d1umma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umma_ a.3.1.0 (A:) automated matches {Methylobacterium extorquens}
sqgkeggrdtpavkkfletgenlyiddksclrngeslfatscsgchghlaegklgpglnd
nywtypsnttdvglfatifggangmmgphnenltpdemlqtiawirhlytgpkqdavwln
deqkkaytpykqgevipkdakgqckplde

SCOPe Domain Coordinates for d1umma_:

Click to download the PDB-style file with coordinates for d1umma_.
(The format of our PDB-style files is described here.)

Timeline for d1umma_: