PDB entry 1umm

View 1umm on RCSB PDB site
Description: cytochrome cl from methylobacterium extorquens
Class: electron transport
Keywords: haem, cytochrome c, electron transport
Deposited on 2003-08-22, released 2004-09-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2005-12-08, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.21
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome cL
    Species: Methylobacterium extorquens
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1umma_
  • Heterogens: CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ummA (A:)
    qpqsgpqtgvvfrntvtgealdvsqgkeggrdtpavkkfletgenlyiddksclrngesl
    fatscsgchghlaegklgpglndnywtypsnttdvglfatifggangmmgphnenltpde
    mlqtiawirhlytgpkqdavwlndeqkkaytpykqgevipkdakgqckplde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ummA (A:)
    sqgkeggrdtpavkkfletgenlyiddksclrngeslfatscsgchghlaegklgpglnd
    nywtypsnttdvglfatifggangmmgphnenltpdemlqtiawirhlytgpkqdavwln
    deqkkaytpykqgevipkdakgqckplde