Lineage for d2d0wa_ (2d0w A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, openedSuperfamily a.3.1: Cytochrome c [46626] (9 families) 
covalently-bound heme completes the core
Family a.3.1.0: automated matches [191374] (1 protein)
not a true familyProtein automated matches [190453] (26 species)
not a true protein
Species Hyphomicrobium denitrificans [TaxId:53399] [187593] (1 PDB entry) 
Domain d2d0wa_: 2d0w A: [163543]
automated match to d2c8sa1
complexed with hem, zn
Details for d2d0wa_
PDB Entry: 2d0w (more details), 1.98 Å
PDB Description: Crystal structure of cytochrome cL from Hyphomicrobium denitrificans
PDB Compounds: (A:) cytochrome cLSCOPe Domain Sequences for d2d0wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0wa_ a.3.1.0 (A:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aqevfrntvtgealdvegqapkegrdtpavkqfmqtgvdpyvevagclpkgeeiylescs
gchghigegkvgpglndsywtypknttdkglfetifggangmmgphgqdleldnmlklia
wirhiqkddvadadwlsdeqkknfkpfdikaweatgkaaaekaqckis
SCOPe Domain Coordinates for d2d0wa_:
Click to download the PDB-style file with coordinates for d2d0wa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2d0wa_:
- d2d0wa_ first appeared in SCOPe 2.01
- d2d0wa_ appears in SCOPe 2.07
View in 3D
