Lineage for d1pn1b_ (1pn1 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014512Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily)
    6 helices: bundle; left-handed twist, up-and-down topology
  4. 2014513Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (1 family) (S)
    automatically mapped to Pfam PF01213
  5. 2014514Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein)
  6. 2014515Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species)
  7. 2014516Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (3 PDB entries)
  8. 2014518Domain d1pn1b_: 1pn1 B: [302898]
    automated match to d1s0pa_
    complexed with mg

Details for d1pn1b_

PDB Entry: 1pn1 (more details), 1.4 Å

PDB Description: Structure of the N-terminal domain of the adenylyl cyclase associated protein (CAP) from Dictyostelium discoideum
PDB Compounds: (B:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1pn1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn1b_ a.192.1.1 (B:) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat

SCOPe Domain Coordinates for d1pn1b_:

Click to download the PDB-style file with coordinates for d1pn1b_.
(The format of our PDB-style files is described here.)

Timeline for d1pn1b_:

  • d1pn1b_ is new in SCOPe 2.06-stable