SCOPe 2.08: Domain d1pn1b_: 1pn1 B:

Lineage for d1pn1b_ (1pn1 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily)
   6 helices: bundle; left-handed twist, up-and-down topology

4. Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (2 families)
   automatically mapped to Pfam PF01213

5. Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein)

6. Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (3 PDB entries)

8. Domain d1pn1b_: 1pn1 B: [302898]
   automated match to d1s0pa_
   complexed with mg

Details for d1pn1b_

PDB Entry: 1pn1, 1.4 Å

PDB Description: Structure of the N-terminal domain of the adenylyl cyclase associated protein (CAP) from Dictyostelium discoideum

PDB Compounds: (B:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1pn1b_:

Sequence; same for both SEQRES and ATOM records:

>d1pn1b_ a.192.1.1 (B:) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat

Timeline for d1pn1b_:

• d1pn1b_ first appeared in SCOPe 2.06
  
• d1pn1b_ appears in SCOPe 2.07