Lineage for d1s0pa_ (1s0p A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736270Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily)
    6 helices: bundle; left-handed twist, up-and-down topology
  4. 2736271Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (2 families) (S)
    automatically mapped to Pfam PF01213
  5. 2736272Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein)
  6. 2736273Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species)
  7. 2736274Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (3 PDB entries)
  8. 2736277Domain d1s0pa_: 1s0p A: [98300]
    complexed with mg

Details for d1s0pa_

PDB Entry: 1s0p (more details), 1.4 Å

PDB Description: Structure of the N-Terminal Domain of the Adenylyl Cyclase-Associated Protein (CAP) from Dictyostelium discoideum.
PDB Compounds: (A:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1s0pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0pa_ a.192.1.1 (A:) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat

SCOPe Domain Coordinates for d1s0pa_:

Click to download the PDB-style file with coordinates for d1s0pa_.
(The format of our PDB-style files is described here.)

Timeline for d1s0pa_: