PDB entry 1pn1

View 1pn1 on RCSB PDB site
Description: Structure of the N-terminal domain of the adenylyl cyclase associated protein (CAP) from Dictyostelium discoideum
Class: membrane protein
Keywords: cyclase associated protein, alpha helix bundle, SIRAS, dimer
Deposited on 2003-06-12, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2004-01-27, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.18
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylyl cyclase-associated protein
    Species: Dictyostelium discoideum
    Gene: CAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54654 (1-175)
      • insertion (0)
    Domains in SCOPe 2.08: d1pn1a_
  • Chain 'B':
    Compound: Adenylyl cyclase-associated protein
    Species: Dictyostelium discoideum
    Gene: CAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54654 (1-175)
      • insertion (0)
    Domains in SCOPe 2.08: d1pn1b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pn1A (A:)
    svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
    elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
    fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pn1B (B:)
    svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
    elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
    fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat