Lineage for d1gw5b_ (1gw5 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006697Family a.118.1.10: Clathrin adaptor core protein [74771] (3 protein domains)
    automatically mapped to Pfam PF01602
  6. 2006704Protein automated matches [190425] (2 species)
    not a true protein
  7. 2006705Species Human (Homo sapiens) [TaxId:9606] [187313] (3 PDB entries)
  8. 2006708Domain d1gw5b_: 1gw5 B: [302451]
    Other proteins in same PDB: d1gw5s_
    automated match to d2vglb_
    complexed with ihp

Details for d1gw5b_

PDB Entry: 1gw5 (more details), 2.59 Å

PDB Description: ap2 clathrin adaptor core
PDB Compounds: (B:) adapter-related protein complex 2 beta 1 subunit

SCOPe Domain Sequences for d1gw5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw5b_ a.118.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnl
elkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylc
eplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaa
lseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicer
vtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyval
rninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyat
evdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypn
kyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqlt
lltaivklflkkpsetqelvqqvlsxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxieptlldelichigslasvyhkppnafv

SCOPe Domain Coordinates for d1gw5b_:

Click to download the PDB-style file with coordinates for d1gw5b_.
(The format of our PDB-style files is described here.)

Timeline for d1gw5b_:

  • d1gw5b_ is new in SCOPe 2.06-stable