Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) |
Family a.118.1.10: Clathrin adaptor core protein [74771] (3 proteins) automatically mapped to Pfam PF01602 |
Protein automated matches [190425] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187313] (5 PDB entries) |
Domain d1gw5b_: 1gw5 B: [302451] Other proteins in same PDB: d1gw5s_ automated match to d2vglb_ complexed with ihp |
PDB Entry: 1gw5 (more details), 2.59 Å
SCOPe Domain Sequences for d1gw5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw5b_ a.118.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} skyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnl elkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylc eplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaa lseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicer vtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyval rninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyat evdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypn kyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqlt lltaivklflkkpsetqelvqqvlsxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxieptlldelichigslasvyhkppnafv
Timeline for d1gw5b_: